DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and PRSS56

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001356777.1 Gene:PRSS56 / 646960 HGNCID:39433 Length:604 Species:Homo sapiens


Alignment Length:249 Identity:76/249 - (30%)
Similarity:108/249 - (43%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKNL--TVRLGEYDWTRQ 99
            ||.||..|...:.||:..|....|.||||.|:.:.:|||||||.:..|..|  ||.|.|.....|
Human   104 RIVGGSAAPPGAWPWLVRLQLGGQPLCGGVLVAASWVLTAAHCFVGAPNELLWTVTLAEGSRGEQ 168

  Fly   100 MDSINPKHRHREYMVTRIYTHPSYRSIAAY-DIALLKLNQTVEYTVAIRPICLVLPENFHEWYWL 163
            .:         |..|.||..||.:.....: |:||::|...|....:.||:|  ||:...|    
Human   169 AE---------EVPVNRILPHPKFDPRTFHNDLALVQLWTPVSPGGSARPVC--LPQEPQE---- 218

  Fly   164 VDSVEDFTLTGWGAT-KTEPVSQVLQSANLTQIDRGTCHDRYGHSV-DHTHICAG--SSKSFACV 224
            ..:.....:.||||. :..|.::.::.|.:..:...||....|..: ..|.:|||  :....:|.
Human   219 PPAGTACAIAGWGALFEDGPEAEAVREARVPLLSTDTCRRALGPGLRPSTMLCAGYLAGGVDSCQ 283

  Fly   225 GDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGV------TVFTNVVSFTEWI 272
            ||||.||... ....|......|:.|.|    ||.      .|:|.|..|.:|:
Human   284 GDSGGPLTCS-EPGPRPREVLFGVTSWG----DGCGEPGKPGVYTRVAVFKDWL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 75/247 (30%)
Tryp_SPc 38..272 CDD:238113 74/246 (30%)
PRSS56NP_001356777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..96
Tryp_SPc 105..335 CDD:238113 75/248 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158882
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.