DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and prozb

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001313449.1 Gene:prozb / 558106 ZFINID:ZDB-GENE-120816-1 Length:395 Species:Danio rerio


Alignment Length:230 Identity:49/230 - (21%)
Similarity:86/230 - (37%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 W-MAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPK-NLTVRLGEYDWTRQMDSINPKHRHREYM 113
            | :.||:.....:|.|.::..:.:||:|.|:..... :.||.:|......::.|..|        
Zfish   191 WEVRFLNASGHDVCHGVILGQKSILTSATCMTALQDLHFTVAVGVSTAAVRVSSWTP-------- 247

  Fly   114 VTRIYTHPSYRSIAAYDIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGAT 178
                  |..:.|....|:..|:|.:.....::..|:|  |||..:....|:.:..:....| |||
Zfish   248 ------HKRFLSGPDDDLCFLELQEPFPPNISTVPLC--LPEKDYSENILMRAGREGVAEG-GAT 303

  Fly   179 KTE-PVSQVLQSANLTQI--DRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRR 240
            .:. .:.....:.|||.:  ::..|..|..         |||.:   |...||||.|.       
Zfish   304 YSYLSLDDCRDALNLTFVMTNKMFCMKRES---------AGSER---CTVSSGSPAAT------- 349

  Fly   241 YIHAQVGI---VSRGPKNCDGVTVFTNVVSFTEWI 272
             :..:...   ||.....|....:||.:..:..|:
Zfish   350 -LEGKTAFLTGVSLSAGRCGDTLLFTKLSRYLHWL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 48/228 (21%)
Tryp_SPc 38..272 CDD:238113 48/228 (21%)
prozbNP_001313449.1 GLA 25..88 CDD:214503
EGF_CA 89..125 CDD:238011
FXa_inhibition 139..167 CDD:291342
Tryp_SPc 182..384 CDD:304450 49/230 (21%)
Tryp_SPc 182..382 CDD:214473 48/227 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.