DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and f9

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001011223.1 Gene:f9 / 496659 XenbaseID:XB-GENE-941626 Length:463 Species:Xenopus tropicalis


Alignment Length:279 Identity:87/279 - (31%)
Similarity:121/279 - (43%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHN--HLQFLCGGSLITSEFVLTAAHCVMPTPK 85
            |.::||       :||.||.|:.....||...|.|  :|.| |.||:|..::::|||||.: ...
 Frog   219 VTVDPN-------VRIVGGTDSLKGEFPWQVHLVNKDNLGF-CSGSIINEKWIVTAAHCFL-IRG 274

  Fly    86 NLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSY---RSIAAYDIALLKLNQTVEYTVAIR 147
            ...|..||:: |...|.....|:     ||||..:|:|   ||....|||||:|.:.:|....:|
 Frog   275 EFKVVAGEHN-TEVSDGTEQHHK-----VTRIILYPAYNATRSKYNNDIALLELEKPLELNDYVR 333

  Fly   148 PICLVLPENFHEWYWLVDSVEDFT-----------LTGWG--ATKTEPVSQVLQSANLTQIDRGT 199
            |:|:              ...|||           ::|||  ..|..| :.:||...:..|::..
 Frog   334 PVCI--------------GNMDFTEKLLKRNAFSMVSGWGDLGYKGRP-AVILQKLAVPYINQAA 383

  Fly   200 CHDRYGHSVDHTHICAGSS--KSFACVGDSGSPLAMKVVHNRRY--IHAQVGIVSRGPKNC---D 257
            |......|:.....|||.|  ....|.||||.|      |...|  :....||.|.|.| |   |
 Frog   384 CKKSSRFSIYANMFCAGYSDESKDTCQGDSGGP------HVTEYKNLWFLTGITSWGEK-CAEKD 441

  Fly   258 GVTVFTNVVSFTEWIFRTT 276
            ...|:|.:..||:||..||
 Frog   442 KYGVYTRLSRFTDWIRTTT 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 80/259 (31%)
Tryp_SPc 38..272 CDD:238113 79/258 (31%)
f9NP_001011223.1 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..165 CDD:317114
Tryp_SPc 227..459 CDD:238113 81/261 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.