DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG10232

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:272 Identity:91/272 - (33%)
Similarity:123/272 - (45%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFL---HNHLQFL---CGGSLITSEFVLTAAHCVMP 82
            :|..:|||.|...|:..|..|.....||||.|   :..|..:   |.||||...:||||||||:.
  Fly   243 VLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVK 307

  Fly    83 TPKNLT------VRLGEYDWTRQMD---SINPKHRHREYMVTRIYTHPSYRSIAAY--DIALLKL 136
            .....|      |||||:|.|...|   :.|......|..:.....|..|.:.:.:  ||||::|
  Fly   308 DKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRL 372

  Fly   137 NQTVEYTVAIRPICL---VLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRG 198
            ...|.||..|.|||:   .:|.:.|          ...:.|||.||....||||.. |....:|.
  Fly   373 QTPVRYTHEILPICVPKDPIPLHNH----------PLQIAGWGYTKNREYSQVLLH-NTVYENRY 426

  Fly   199 TCHDRYGHSVDHTHICA-GSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDG--VT 260
            .|.|:.....:.:.||| |.....:|.||||.||.:.:.::.:.|....||||.|.:||..  ..
  Fly   427 YCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPG 491

  Fly   261 VFTNVVSFTEWI 272
            |:|...:|..||
  Fly   492 VYTKTGAFFSWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 84/257 (33%)
Tryp_SPc 38..272 CDD:238113 83/256 (32%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 85/255 (33%)
Tryp_SPc 260..503 CDD:214473 83/253 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.