DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG33465

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:278 Identity:93/278 - (33%)
Similarity:133/278 - (47%) Gaps:20/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISYLLVSSIIANQLLYGLAVLLEPNCGQIPFRMRIFGGMDAGLVST-PWMAFLHNHLQFLCGGSL 67
            :|.:|..::|...|..|||.||:..|........|  ..:.|...| ||||.::.:.||:|.|:|
  Fly     1 MSRVLSLALIGLVLCQGLAQLLDKKCHDPKTSENI--NFNHGATETAPWMASIYKNNQFICDGTL 63

  Fly    68 ITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYR-SIAAYDI 131
            :...||||||.|: .....|.|..|.|:..|.....   ..:.:|.|.....|.::| :....||
  Fly    64 VHKLFVLTAASCI-SKDSQLYVLFGMYNQYRDASQF---FNNEQYGVAVALQHSNFRPNNGVNDI 124

  Fly   132 ALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSV--EDFTLTGWGATKTEPVSQVLQSANLTQ 194
            .||:|...|.:...|||||::|..       :|.|.  |.|...||....||..|||.|:..|:|
  Fly   125 GLLRLYGEVTHYAHIRPICIILDH-------VVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQ 182

  Fly   195 IDRGTCHDRYGH--SVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCD 257
            .....|| |.|.  .::....|||:.....|..:|||||.....:..:.|..|||:||.|.:.|.
  Fly   183 KKPFECH-RNGQLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCS 246

  Fly   258 GVTVFTNVVSFTEWIFRT 275
            ..:|:|:||:|.:||:.|
  Fly   247 PTSVYTDVVAFKDWIYNT 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 80/240 (33%)
Tryp_SPc 38..272 CDD:238113 80/239 (33%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 79/229 (34%)
Tryp_SPc 46..261 CDD:214473 77/226 (34%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.