DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG9897

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:303 Identity:63/303 - (20%)
Similarity:96/303 - (31%) Gaps:124/303 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMP-TPKNLTVRLGEYDWTRQM 100
            ||..|....:...||.|.:..:.:..|||::|:..::||||.||.. :.:::.||||........
  Fly    22 RIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCVDGYSARSIQVRLGTSSCGTSG 86

  Fly   101 DSINPKHRHREYMVTRIYTHPSYRSIAAYD--IALLKLNQTVEYTVAIRPI-------------- 149
            ....         :.::..|..|.| ..:|  :||||..:.:..|..|:||              
  Fly    87 SIAG---------ICKVKVHSQYSS-WRFDNNLALLKTCELLNTTDEIKPIERADKVPDDNSRAN 141

  Fly   150 ---------------------------CLVLPENFH--------------EW----YWLVDSVED 169
                                       |..||...|              :|    ::|:..:.|
  Fly   142 VTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADWKVIPFYLLKGISD 206

  Fly   170 FTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMK 234
            .|                                         ||..|....||..|.||||   
  Fly   207 LT-----------------------------------------ICTKSPGKGACSTDRGSPL--- 227

  Fly   235 VVHNRRYIHAQVGIVSRGPKNCD-GVTVFTNVVSFTEWIFRTT 276
            |:.|:     .|||:||.  .|. ...|:.|::..|.|:...|
  Fly   228 VIDNK-----LVGILSRA--GCSIKPDVYANILGHTNWLDSNT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 61/297 (21%)
Tryp_SPc 38..272 CDD:238113 60/296 (20%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 61/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.