DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG30283

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:257 Identity:92/257 - (35%)
Similarity:140/257 - (54%) Gaps:25/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEPNCGQIPF-RMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKNLT 88
            ||..||.:|. :.:|.||.:|.:.|.||||.:.....|.|||:|||:.||||:|||:  ....|.
  Fly    29 LEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRFVLTSAHCI--ANGELK 91

  Fly    89 VRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYRSIAAYDIALLKLNQTVEYTVAIRPICLVL 153
            ||||..:  |:.::       :::.|..::.|..| ....:|:|||:|.:.|.|:..|.||||:|
  Fly    92 VRLGVLE--REAEA-------QKFAVDAMFVHTDY-YFDQHDLALLRLAKRVHYSDNISPICLLL 146

  Fly   154 PENFHEWYWLVDSVED----FTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYGH-SVDHTHI 213
            ..       ||.::::    |...|||.|::...|::||..:|..:.|..|..:|.| .::..||
  Fly   147 DP-------LVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHI 204

  Fly   214 CAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVTVFTNVVSFTEWIFRT 275
            ||.|:.:..|.||||.||...|.::...:..|.|:.|.|..:|...||||||::..:||..|
  Fly   205 CAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKATVFTNVMTHLDWIVNT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 84/239 (35%)
Tryp_SPc 38..272 CDD:238113 84/238 (35%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 84/239 (35%)
Tryp_SPc 43..266 CDD:238113 86/241 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.