DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and Prss56

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:249 Identity:79/249 - (31%)
Similarity:106/249 - (42%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKNL--TVRLGEYDWTRQ 99
            ||.||..|.|.:.||:..|......||||.|:.:.:|||||||.......|  ||.|.|.....|
  Rat   111 RIVGGSTAPLGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNELLWTVMLAEGPQGEQ 175

  Fly   100 MDSINPKHRHREYMVTRIYTHPSYRSIAAY-DIALLKLNQTVEYTVAIRPICLVLPENFHEWYWL 163
            .:         |..|.||..||.:.....: |:||::|...|......||||  |||...|    
  Rat   176 AE---------EVQVNRILPHPKFDPQTFHNDLALVQLWTPVNSEGPARPIC--LPEGSRE---- 225

  Fly   164 VDSVEDFTLTGWGAT-KTEPVSQVLQSANLTQIDRGTCHDRYGHSVD-HTHICAG--SSKSFACV 224
            ..:....|:.||||. :..|.|:.::.|.:..:...||....|..:. .|.:|||  :....:|.
  Rat   226 PPAGTPCTIAGWGALFEDGPESEAVREARVPLLSADTCQKALGPGLSPSTMLCAGYLAGGIDSCQ 290

  Fly   225 GDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGV------TVFTNVVSFTEWI 272
            ||||.||... ....|......|:.|.|    ||.      .|:|.|..|.:|:
  Rat   291 GDSGGPLTCS-EPGPRPREVLFGVTSWG----DGCGEPGKPGVYTRVAVFKDWL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 78/247 (32%)
Tryp_SPc 38..272 CDD:238113 77/246 (31%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.