DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG1773

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:281 Identity:93/281 - (33%)
Similarity:128/281 - (45%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEPNCG----QIP---FRMRIFGGMDAGLVSTPWMAFLH--NHLQFL-CGGSLITSEFVLTAAH 78
            |.:.:||    .||   .|.||.||..:.|:|.|||||||  ..::.. |||||::..|||||||
  Fly    41 LTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAH 105

  Fly    79 C--VMPTPKNLTVRLGEYDWTRQMDSINPKHRH------REYMVTRIYTHPSYRSI-AAYDIALL 134
            |  :.|..|.:.|.|||.|.:...|.:...::.      .|:.:.:...|..:... ..|||||:
  Fly   106 CFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALI 170

  Fly   135 KLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTL--------TGWGATKTEPVSQVLQSAN 191
            |||:.|.:...||||||.          |.|.:..|||        .|||.|::.      :.||
  Fly   171 KLNKKVVFKDHIRPICLP----------LTDELLAFTLQLGQSYMAVGWGRTESR------RFAN 219

  Fly   192 LT---QIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGP 253
            .|   .|:...|.|    ..|.:.:||.......|.||||.||..|.....:....|.|:||.|.
  Fly   220 STMEVHINTEKCTD----GRDTSFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGS 280

  Fly   254 KNCDG--VTVFTNVVSFTEWI 272
            :||..  ...:.:|.::..||
  Fly   281 QNCGAGQKAYYMDVPTYVPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 85/259 (33%)
Tryp_SPc 38..272 CDD:238113 84/258 (33%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 85/259 (33%)
Tryp_SPc 62..301 CDD:238113 84/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.