DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG14227

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:288 Identity:93/288 - (32%)
Similarity:147/288 - (51%) Gaps:28/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KYISYLLVSSIIANQLL---YGLAVLLEPNCGQ-IPFRMRI----FGGMDAGLVSTPWMAFLHNH 58
            |.|:.||:  :.|:..|   .|.|.||:..||: :|...::    :......:.:.||:..:..:
  Fly     3 KVIAALLI--LFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVN 65

  Fly    59 LQFLCGGSLITSEFVLTAAHCVMPTPKNLTVRLGEYD-WTRQMDSINPKHRHREYMVTRI---YT 119
            .:..|.||||...|||||||||.  .:.:.|.||::| |....:..:.......|.| ||   ..
  Fly    66 GKAKCSGSLINHRFVLTAAHCVF--REAMQVHLGDFDAWNPGQNCSSGARLSNAYCV-RIDKKIV 127

  Fly   120 HPSYRSIAA--YDIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTE- 181
            |..:..|.|  |||.||::...|:|:..:|||||::.|.       |.:::.|.||.||.|..: 
  Fly   128 HAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEP-------VAAIDRFQLTVWGTTAEDF 185

  Fly   182 -PVSQVLQSANLTQIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQ 245
             .:.:||:.:...:|||..|..::...||.:.||..:..|.||.||||.|.:.|:::...|...|
  Fly   186 RSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQ 250

  Fly   246 VGIVSRGPKNCDGVTVFTNVVSFTEWIF 273
            .||:..|..:|.|::|.|||..:.:||:
  Fly   251 FGIIIFGLSSCAGLSVCTNVTFYMDWIW 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 78/246 (32%)
Tryp_SPc 38..272 CDD:238113 78/245 (32%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 78/229 (34%)
Tryp_SPc 57..277 CDD:238113 78/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.