DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG9672

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:254 Identity:62/254 - (24%)
Similarity:98/254 - (38%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKN-------LTVRLGEY 94
            ||.||.||.|...|:.|.|.....:.||..:|...:.|||..||....|:       ..|.:|..
  Fly    24 RIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVGSV 88

  Fly    95 DWTRQMDSINPKHRHREYMVTRIYTHPSYRSIAAYDIALLKLNQTVEY--TVAIRPICLVLPENF 157
            |          .:..::..|..|..:|:|.::.. .||||:|.:.:.:  ||...|:...:|.  
  Fly    89 D----------LYNGKQIRVEEITINPNYSTLKT-GIALLRLQEEITFSETVNAIPLSQDVPP-- 140

  Fly   158 HEWYWLVDSVEDFTLTGWGATKTEPVS--QVLQSANLTQIDRGTC----HDRYGHSVDHTHICAG 216
                 :...||   ::|||.|....|:  :.||......:....|    .|....:.|.. :|.|
  Fly   141 -----MGSQVE---VSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQV-LCLG 196

  Fly   217 -SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVTV--FTNVVSFTEWI 272
             ..:...|.||.|.|..        |....||:.::....|.|:..  |.::.:..:||
  Fly   197 HGRRQGICSGDIGGPAV--------YQGQLVGLGAQILGECGGMLPERFISIAANYDWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 60/252 (24%)
Tryp_SPc 38..272 CDD:238113 59/251 (24%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 60/252 (24%)
Tryp_SPc 25..250 CDD:238113 61/253 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.