DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and Proz

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001296362.1 Gene:Proz / 306608 RGDID:1308666 Length:406 Species:Rattus norvegicus


Alignment Length:169 Identity:46/169 - (27%)
Similarity:72/169 - (42%) Gaps:36/169 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 STPWMAFLHN-HLQFLCGGSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHRE 111
            |.||...|.| ..:..|.|.|:...||||.|.|.: ...||:|:..:    .|...|...|.|..
  Rat   199 SFPWQVRLTNSEGEDFCAGVLLQENFVLTTAKCSL-LHSNLSVKADD----DQQIRIKSAHVHMR 258

  Fly   112 YMVTRIYTHPSYRSIAAYDIALLKLNQTVEYTVAIRPICLVLPE-NFHEWY-----------WLV 164
            |          .:.....|::||:|.:.::..:...|:|  :|| :|.|..           |::
  Rat   259 Y----------DKETGENDVSLLELEKPLQCPIPALPVC--VPERDFAEHVLIPGTKGVLSGWML 311

  Fly   165 DSVE-DFTLTGWGATKT--EPVSQVLQSANLTQIDRGTC 200
            :.:: |.|||....|:|  |...|:|   |:|...|.:|
  Rat   312 NGIDLDRTLTMLSVTQTDGEECGQIL---NVTVTTRTSC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 46/169 (27%)
Tryp_SPc 38..272 CDD:238113 46/169 (27%)
ProzNP_001296362.1 GLA 27..89 CDD:214503
EGF_CA <99..126 CDD:238011
FXa_inhibition 140..169 CDD:291342
Tryp_SPc 199..404 CDD:304450 46/169 (27%)
Trypsin 199..>347 CDD:278516 45/167 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.