DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and F10

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:259 Identity:76/259 - (29%)
Similarity:116/259 - (44%) Gaps:44/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MRIFGGMDAGLVSTPWMAFLHN--HLQFLCGGSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTR 98
            :||.||.:......||.|.|.:  .....|||:::...::|||||| :...|...||:|:.: |.
  Rat   230 IRIVGGQECKRGECPWQALLFSDEETDGFCGGTILNEFYILTAAHC-LHQAKRFKVRVGDLN-TE 292

  Fly    99 QMDSINPKHRHREYMVTRIYTHPSY-RSIAAYDIALLKLNQTVEYTVAIRPICLVLPENFHEWYW 162
            |.|.....|.     |..|..|..: |....:|||:|:|...:.:...:.|.|  ||:.  :|  
  Rat   293 QEDGGEMVHE-----VDMIIKHNKFQRDTYDFDIAMLRLKTPITFRENVAPAC--LPQK--DW-- 346

  Fly   163 LVDSVEDFTL--------TGWGATKTE-PVSQVLQSANLTQIDRGTCHDRYGHSVDHTHICAG-- 216
                 .:.||        :|:|.|..: ..|:||:...:..:||.||......|:.....|||  
  Rat   347 -----AEATLMTQKTGIVSGFGRTHEKGRQSKVLKMMEVPYVDRNTCRLSTSFSITQNMFCAGYD 406

  Fly   217 SSKSFACVGDSGSPLAMKVVHNRRY--IHAQVGIVSRGPKNC---DGVTVFTNVVSFTEWIFRT 275
            :.:..||.||||.|      |..|:  .:...||||.| :.|   ....::|.|.:|.:||.|:
  Rat   407 AKQEDACQGDSGGP------HVTRFKDTYFVTGIVSWG-EGCARKGKYGIYTKVTAFLKWIDRS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 73/253 (29%)
Tryp_SPc 38..272 CDD:238113 72/252 (29%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372
Tryp_SPc 232..462 CDD:238113 74/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.