DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and f10

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_958870.3 Gene:f10 / 282670 ZFINID:ZDB-GENE-021206-9 Length:504 Species:Danio rerio


Alignment Length:250 Identity:76/250 - (30%)
Similarity:125/250 - (50%) Gaps:35/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIFGGMDAGLVSTPWMAFL--HNHLQFLCGGSLITSEFVLTAAHCVMPTPKNLTVR--LGEYDWT 97
            ||..|::......||.|.|  .|::.| |||:::|..|:|:||||:   .::|::|  :|||   
Zfish   244 RIVNGVECPPGDCPWQALLINENNMGF-CGGTILTEHFILSAAHCM---NESLSIRVVVGEY--- 301

  Fly    98 RQMDSINPKHRHREYMVTRIYTHPSYRSIAAY-DIALLKLNQTVEYTVAIRPICLVLPE-NFHEW 160
               |::.|:.|...:.|..|..|.:|:....: ||||:||::.:::|..|.|.|  ||| .|.| 
Zfish   302 ---DTLVPEGREATHDVDEILIHKNYQPDTYHNDIALIKLSKPIKFTKYIIPAC--LPEMKFAE- 360

  Fly   161 YWLVDSVEDFTLTGWGATKTEPVSQ-VLQSANLTQIDRGTCHDRYGHSVDHTHICAG--SSKSFA 222
             .::...:|..::|:|..:...:|. :||...:..::|..|.:.....:.....|||  ..:..|
Zfish   361 -RVLMQQDDGLVSGFGRVREGGLSSTILQKLTVPYVNRAKCIESSNFKISGRMFCAGYDQEEKDA 424

  Fly   223 CVGDSGSPLAMKVVHNRRYIHAQ--VGIVSRGPKNC---DGVTVFTNVVSFTEWI 272
            |.||||.|      |..|:.:..  .|:||.| :.|   ....|:|.|..:..||
Zfish   425 CQGDSGGP------HVTRFKNTWFITGVVSWG-EGCARKGKYGVYTQVSKYIMWI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 74/248 (30%)
Tryp_SPc 38..272 CDD:238113 73/247 (30%)
f10NP_958870.3 GLA 19..82 CDD:214503
EGF_CA 83..119 CDD:238011
FXa_inhibition 126..161 CDD:291342
Tryp_SPc 244..472 CDD:214473 74/248 (30%)
Tryp_SPc 245..474 CDD:238113 74/248 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.