DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG18420

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:278 Identity:103/278 - (37%)
Similarity:149/278 - (53%) Gaps:23/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SYLLVSSIIANQLLYGLAVLLEPNCG-QIPFRM--RIFGGMDAGLVSTPWMAFLH-NHLQFLCGG 65
            |.||:.::..   |.|....|:..|| :.|.::  ||..|..|...|:||||||| :..||:|||
  Fly    10 SILLLLTVFP---LLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGG 71

  Fly    66 SLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSY-RSIAAY 129
            :||:...|||||||.:|. ..:.||||||:  |::     |....|:.|.|.:.|..| .:..|.
  Fly    72 TLISRRLVLTAAHCFIPN-TTIVVRLGEYN--RKL-----KGYREEHQVNRTFQHRFYDPNTHAN 128

  Fly   130 DIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQ 194
            |||||:|...|.|...|||||::...:   |...:||::..|.||||.|::...|..|::.::::
  Fly   129 DIALLRLVSNVVYKANIRPICIMWDAS---WKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISR 190

  Fly   195 IDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGV 259
            .....|  .:| ||.....|||:..|..|:||:|.|:...|.:...:...||||.... |.|...
  Fly   191 QPSKMC--AFG-SVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITN-KRCQRP 251

  Fly   260 TVFTNVVSFTEWIFRTTL 277
            :|||:|:|..|:|.|..|
  Fly   252 SVFTDVMSHIEFIRRIFL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 91/236 (39%)
Tryp_SPc 38..272 CDD:238113 90/235 (38%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 91/236 (39%)
Tryp_SPc 43..267 CDD:238113 91/238 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.