DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG33225

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:297 Identity:100/297 - (33%)
Similarity:152/297 - (51%) Gaps:46/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SYLLVSSII--ANQLL---YGLAVLLEPNCG--QIPFRM-RIFGGMDAGLVSTPWMAFLHNHLQF 61
            :|:.|:.|:  |:.:|   .|.:.||..:||  :.|.|: |:.||.||...:.|||..:......
  Fly    16 TYIFVAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNV 80

  Fly    62 LCGGSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWT---------RQMDSINPKHRHREYMVTRI 117
            .|.|||||..||||:|.|::..||.  |.|||||..         ||:..|:.|..|.::     
  Fly    81 FCSGSLITRLFVLTSASCLLSLPKQ--VILGEYDRNCTSADCTSIRQVIDIDQKIIHGQF----- 138

  Fly   118 YTHPSYRSIAAYDIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEP 182
                ...::..||||||:|.:.|..:..:|||||.:......      ||:.||.||||.|:...
  Fly   139 ----GLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGR------SVQHFTATGWGTTEWNE 193

  Fly   183 VSQVLQSANLTQIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVV---------HN 238
            .|.:||:..|::|:|..|..|...::|.:.:|.|..:...|.||:|.||::.:.         .:
  Fly   194 PSTILQTVTLSKINRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKS 258

  Fly   239 RRYIHAQVGIVSRGPKNCDGVTVFTNVVSFTEWIFRT 275
            |.::   :||||.|..:|.|:.|:|||..:.:||.||
  Fly   259 RAFL---IGIVSYGSSSCSGIGVYTNVEHYMDWIVRT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 84/252 (33%)
Tryp_SPc 38..272 CDD:238113 83/251 (33%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 84/252 (33%)
Tryp_SPc 57..292 CDD:238113 85/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.