DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG33226

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:281 Identity:108/281 - (38%)
Similarity:147/281 - (52%) Gaps:20/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISYLLVSSIIANQLLYGLAV-LLEPNCGQIP--FRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGG 65
            :.:|||..|:|.:....|.. ||:|||.|.|  .|.:|.||.:|.:...|||..:.......|||
  Fly    10 MKWLLVCFILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGG 74

  Fly    66 SLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHR---------HREYMVTRIYTHP 121
            |||:|.||||||||  .:...|.||.|.|      ..|.|::.         ..|..|.||:.|.
  Fly    75 SLISSLFVLTAAHC--HSRYRLKVRFGRY------SGITPRYLCSSQYCSPFGPEIDVKRIFLHS 131

  Fly   122 SYRSIAAYDIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQV 186
            |||....|||||..|.:.|.|.|..||||::...|..:....::.|..|.:||||.|:::..|.:
  Fly   132 SYRDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTI 196

  Fly   187 LQSANLTQIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSR 251
            ||:.:|..:||..|...:...:...|||||.|:|..|.||||.||:.::..:........||:|.
  Fly   197 LQTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISY 261

  Fly   252 GPKNCDGVTVFTNVVSFTEWI 272
            |..||..|||||||:.::.||
  Fly   262 GAPNCREVTVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 92/243 (38%)
Tryp_SPc 38..272 CDD:238113 92/242 (38%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 94/244 (39%)
Tryp_SPc 47..282 CDD:214473 92/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.