DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG33458

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:279 Identity:125/279 - (44%)
Similarity:166/279 - (59%) Gaps:5/279 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYISYLLVSSIIANQLLYGLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGG 65
            ||.|..||...|:.:.:..|.:.|||.:||...:..||.||.|:.|:..||:|:||.:.:|:|||
  Fly     1 MKLIPALLALLILGHGISLGYSYLLEWDCGISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGG 65

  Fly    66 SLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPK--HRHREYMVTRIYTHPSYRSIAA 128
            ||:...||||||||.......:.|||||.|.::::|....:  ..|.|||:.:...||.||:...
  Fly    66 SLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHY 130

  Fly   129 YDIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLT 193
            |||||.|||:.|.||.:||||||:|..|   |...||::..|.:||||||....||..||...:.
  Fly   131 YDIALAKLNRYVVYTDSIRPICLMLNPN---WQVYVDTIRYFIITGWGATNASEVSDKLQLTRIP 192

  Fly   194 QIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDG 258
            ||||.||...:|:.||.||||||.||.:...||||.||...|.:.......|.||||...:...|
  Fly   193 QIDRFTCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHG 257

  Fly   259 VTVFTNVVSFTEWIFRTTL 277
            |:||||::|::.||.||.:
  Fly   258 VSVFTNILSYSNWIHRTII 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 109/236 (46%)
Tryp_SPc 38..272 CDD:238113 108/235 (46%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 109/236 (46%)
Tryp_SPc 38..274 CDD:238113 110/238 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.