DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and F7

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_690059.1 Gene:F7 / 260320 RGDID:628678 Length:446 Species:Rattus norvegicus


Alignment Length:291 Identity:87/291 - (29%)
Similarity:127/291 - (43%) Gaps:62/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEPNCGQIPF---------RMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCV 80
            :|..||:||.         :.||.||........||.|.|..:...|||..|:.:.:::|||||.
  Rat   172 VEYPCGRIPVVEKRNFSRPQGRIVGGYVCPKGECPWQAVLKFNEALLCGAVLLDTRWIVTAAHCF 236

  Fly    81 MPTPK--NLTVRLGEYDW-----TRQMDSINPKHRHREYMVTRIYTHPSYRSIAAYDIALLKLNQ 138
            ....|  |:||.|||:|:     |.|:..:      .:.::...||    |....:||||::|::
  Rat   237 DKFGKLVNITVVLGEHDFSEKEGTEQVRLV------EQVIMPNKYT----RGRTDHDIALVRLHR 291

  Fly   139 TVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGW------GATKTEPVSQVLQSANLTQIDR 197
            .|.:|..:.|:|  |||.......|. |:....::||      |||..|  ..|::...|...| 
  Rat   292 PVTFTDYVVPLC--LPERAFSENTLA-SIRFSRVSGWGQLLDRGATALE--LMVIEVPRLMTQD- 350

  Fly   198 GTCHDRYGHSVDHTHI-----CAG--SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKN 255
              |.:...||.:...|     |||  .....||.||||.|.|.. .|...|:   .|:||.| :.
  Rat   351 --CLEHAKHSANTPRITENMFCAGYMDGTKDACKGDSGGPHATH-YHGTWYL---TGVVSWG-EG 408

  Fly   256 CDG---VTVFTNVVSFTEWIFRTTLYDAKYM 283
            |..   :.|:|.|..:.:|:       .|||
  Rat   409 CAAIGHIGVYTRVSQYIDWL-------VKYM 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 78/257 (30%)
Tryp_SPc 38..272 CDD:238113 77/256 (30%)
F7NP_690059.1 GLA 25..85 CDD:214503
EGF_CA 87..123 CDD:238011
Tryp_SPc 194..430 CDD:238113 78/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.