DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and Proc

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_008770240.3 Gene:Proc / 25268 RGDID:3411 Length:500 Species:Rattus norvegicus


Alignment Length:268 Identity:83/268 - (30%)
Similarity:121/268 - (45%) Gaps:42/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEPNCGQIPFRMRIFGGMDAGLVSTPWMA-FLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKNLT 88
            ::|...::....||..|.......:||.| .|.:..:..|||.||.:.:||||||| :.:.|.||
  Rat   239 IDPEDEELELGPRIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHC-LESSKKLT 302

  Fly    89 VRLGEYD------WTRQMDSINPKHRHREYMVTRIYTHPSY-RSIAAYDIALLKLNQTVEYTVAI 146
            |||||||      |...:|            :..:..||:| ||.:..|||||:|:|....:..|
  Rat   303 VRLGEYDLRRRDPWELDLD------------IKEVLVHPNYTRSNSDNDIALLRLSQPATLSKTI 355

  Fly   147 RPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQ-------VLQSANLTQIDRGTCHDRY 204
            .||||.......|   |..:.::..:|||| .:::.|..       :|....:....|..|....
  Rat   356 VPICLPNSGLAQE---LSQAGQETVVTGWG-YQSDKVKDGRRNRTFILTFIRIPLAARNDCMQVM 416

  Fly   205 GHSVDHTHICAG--SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNC---DGVTVFTN 264
            .:.|....:|||  .....||.||||.|:.:..    |.....||:||.| :.|   :...|:|.
  Rat   417 NNVVSENMLCAGIIGDTRDACDGDSGGPMVVFF----RGTWFLVGLVSWG-EGCGHLNNYGVYTK 476

  Fly   265 VVSFTEWI 272
            |.|:.:||
  Rat   477 VGSYLKWI 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 80/254 (31%)
Tryp_SPc 38..272 CDD:238113 79/253 (31%)
ProcXP_008770240.3 GLA 65..125 CDD:214503
EGF_CA 126..170 CDD:238011
FXa_inhibition 178..213 CDD:405372
Tryp_SPc 252..486 CDD:238113 81/255 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.