DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and F9

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:286 Identity:77/286 - (26%)
Similarity:125/286 - (43%) Gaps:43/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVSSIIANQLLYGLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSE 71
            |::..|..:.:|..|....||    |....|:.||.:|.....||...|:..::..|||::|..:
  Rat   201 LILDDITNSTILDNLTENSEP----INDFTRVVGGENAKPGQIPWQVILNGEIEAFCGGAIINEK 261

  Fly    72 FVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYRSIA---AYDIAL 133
            :::|||||:.|..| :.|..||::...:.|:...::      |.|...|..|.:..   ::||||
  Rat   262 WIVTAAHCLKPGDK-IEVVAGEHNIDEKEDTEQRRN------VIRTIPHHQYNATINKYSHDIAL 319

  Fly   134 LKLNQTVEYTVAIRPICLVLPE------NFHEWYWLVDSVEDFTLTGWGA--TKTEPVSQVLQSA 190
            |:|::.:.....:.|||:...|      .|...|          ::|||.  .|....| :||..
  Rat   320 LELDKPLILNSYVTPICVANKEYTNIFLKFGSGY----------VSGWGKVFNKGRQAS-ILQYL 373

  Fly   191 NLTQIDRGTCHDRYGHSVDHTHICAG--SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGP 253
            .:..:||.||......|:.:...|||  .....:|.||||.|...: |....::   .||:|.| 
  Rat   374 RVPLVDRATCLRSTKFSIYNNMFCAGYREGGKDSCEGDSGGPHVTE-VEGTSFL---TGIISWG- 433

  Fly   254 KNC---DGVTVFTNVVSFTEWIFRTT 276
            :.|   ....::|.|..:..||...|
  Rat   434 EECAMKGKYGIYTKVSRYVNWIKEKT 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 67/250 (27%)
Tryp_SPc 38..272 CDD:238113 66/249 (27%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 227..455 CDD:214473 67/250 (27%)
Tryp_SPc 228..458 CDD:238113 68/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.