DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG30289

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:280 Identity:103/280 - (36%)
Similarity:146/280 - (52%) Gaps:32/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVSSIIANQLLYGLAVLLEPNCG---QIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLIT 69
            ||...|||..:  ::.||..|||   ..|:...||||....:...|||..:.:...  ||||||.
  Fly    11 LVCLFIANNNV--MSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKP--CGGSLIA 71

  Fly    70 SEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIY--------THPSYRSI 126
            .:|||||||||  :.::|.||||:|:....|......|     .:.:.|        .|.:|..|
  Fly    72 RQFVLTAAHCV--SFEDLYVRLGDYETLDPMPYCLNNH-----CIPKFYNISVDMKIVHENYNGI 129

  Fly   127 AAY-DIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSA 190
            ... |||||::::.|||:..:|||||::.|.       :.|:..||:||||.|:....|::|.:|
  Fly   130 TLQNDIALLRMSEAVEYSDYVRPICLLVGEQ-------MQSIPMFTVTGWGETEYGQFSRILLNA 187

  Fly   191 NLTQIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKN 255
            .|..:|...|:.::....|.:.|||||..|..|.||||.||:.|..:..|.:..|.|:||.|.:.
  Fly   188 TLYNMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSER 252

  Fly   256 C--DGVTVFTNVVSFTEWIF 273
            |  :...|:|||....||||
  Fly   253 CAANVAGVYTNVSYHREWIF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 89/245 (36%)
Tryp_SPc 38..272 CDD:238113 89/244 (36%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 89/244 (36%)
Tryp_SPc 42..271 CDD:238113 89/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 1 0.950 - 0 Normalized mean entropy S7758
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.