DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG30288

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:265 Identity:102/265 - (38%)
Similarity:145/265 - (54%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEPNCGQIP---FRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPK 85
            |||.:||...   :|.||.||.|||:.|.|||..:....:.:|||||||:.|||||.||:  :|.
  Fly    26 LLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCI--SPM 88

  Fly    86 NLTVRLGEYDWTRQMDSINPKHRHREYMVT-RIYTHPSYRSIA----AYDIALLKLNQTVEYTVA 145
            .:.||||||| ||     :|.....:::.| |.|.....|.|.    .|||.||::.::|.::..
  Fly    89 YMNVRLGEYD-TR-----HPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYDIGLLRMQRSVIFSNY 147

  Fly   146 IRPICLVL-------PENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDR 203
            :|||||:|       |.          |:..|..||||..........||:|.|.|:.:.:| :|
  Fly   148 VRPICLILGKTLGGNPL----------SILRFNFTGWGTNSDGEEQDRLQTATLQQLPQWSC-ER 201

  Fly   204 YGHSVDHTHICAGSSKSFACVGDSGSPL-AMKVVHNRRYIHAQVGIVSRGPKNCDGVTVFTNVVS 267
            .|..:|.::|||||..|.:|.||||.|| |::....:..:. |.|:.|:|.:.|.|:.::|||..
  Fly   202 PGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVF-QFGVASQGLRLCSGLGIYTNVTH 265

  Fly   268 FTEWI 272
            ||:||
  Fly   266 FTDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 94/247 (38%)
Tryp_SPc 38..272 CDD:238113 93/246 (38%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 94/247 (38%)
Tryp_SPc 45..270 CDD:238113 92/244 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.