DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG30287

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:276 Identity:109/276 - (39%)
Similarity:144/276 - (52%) Gaps:18/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVSSIIANQLLYGLAVLLEPNC---GQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLI 68
            ||::.:...  :.|...||:|.|   ...|...|:..|..|.|.|.|||..:.......||||||
  Fly    10 LLIALVFLK--VQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLI 72

  Fly    69 TSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMD--SINPKHRHREYMVTRIYTHPSYRSIAAYDI 131
            |..:|||||||...|...||||||:||..:.:|  |.....|.||..|||.|....|.:....||
  Fly    73 TPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDI 137

  Fly   132 ALLKLNQTVEYTVAIRPICLVLPENFHEWYW---LVDSVEDFTLTGWGATKTEPVSQVLQSANLT 193
            |||:|..||:|...||.|||::    .::.|   ::.::..|..||||.|::...|.|||.|:||
  Fly   138 ALLRLETTVQYGDNIRSICLLM----GDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLT 198

  Fly   194 QIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLA--MKVVHNRRYIHAQVGIVSRGPKNC 256
            ......|...:|..:|.:|||..||....|.||||.||.  :::...||.|  ..|:||.|..:|
  Fly   199 HHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVI--LFGVVSYGAVHC 261

  Fly   257 DGVTVFTNVVSFTEWI 272
            .|.||:|||:.|..||
  Fly   262 FGPTVYTNVIHFANWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 99/241 (41%)
Tryp_SPc 38..272 CDD:238113 98/240 (41%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 99/241 (41%)
Tryp_SPc 42..280 CDD:238113 100/242 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.