DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG30286

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:260 Identity:86/260 - (33%)
Similarity:134/260 - (51%) Gaps:13/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YGLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPT 83
            :..|..|||:||.:...........|.:..:||||:||...:.:|||:|:...|:||||||:. .
  Fly    16 HATAQFLEPDCGYMSPEALQNEEHQAHISESPWMAYLHKSGELVCGGTLVNHRFILTAAHCIR-E 79

  Fly    84 PKNLTVRLGEYDWTRQM-----DSINPKHRHREYMVTRIYTHPSY-RSIAAYDIALLKLNQTVEY 142
            .:||||||||::....:     |.:.|.   .::.:...:.|..| |:...:||.||:|.::|||
  Fly    80 DENLTVRLGEFNSLTSIDCNGSDCLPPS---EDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEY 141

  Fly   143 TVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYGHS 207
            .|.|:||||:.......   .::.:.....||||.:.:|..:.:|:|..:|:::.|.|...|...
  Fly   142 KVHIKPICLITNTTLQP---KIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTYWVD 203

  Fly   208 VDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVTVFTNVVSFTEWI 272
            .....||.......:|.||||.|:...:..:.|.:..||||||.|...|...:|||||:...:||
  Fly   204 RRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPSVFTNVMEHIDWI 268

  Fly   273  272
              Fly   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 78/240 (33%)
Tryp_SPc 38..272 CDD:238113 78/239 (33%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 80/237 (34%)
Tryp_SPc 39..268 CDD:214473 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.