DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG30187

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:264 Identity:94/264 - (35%)
Similarity:137/264 - (51%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTP 84
            |.::.|:..|| |...::|.||.:|...::.|||.:||...|:|||:||...||||||||::...
  Fly    19 GASIFLDQICG-INIALKITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQD 82

  Fly    85 KNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYRSIAAY--DIALLKLNQTVEYTVAIR 147
            .. :|.||.|:.:...|        |:.::|.: .|.|:...|:|  ||.||||:..|.:...||
  Fly    83 VQ-SVSLGAYNKSDPAD--------RKDVITAV-VHSSFDVRASYENDIGLLKLSSDVIFNALIR 137

  Fly   148 PICLVLPENF--HEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYGHSVDH 210
            |||:||.::.  |     :.::..|...|||..:....|.:||:..|..:||..|:.........
  Fly   138 PICIVLNKSMANH-----MRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVYPSE 197

  Fly   211 THICAGSSKSFACVGDSGSPLAMKV----VHNRRYIHAQVGIVSRGPKNCDGVTVFTNVVSFTEW 271
            ..||||......|.||||.||...|    :.||   ..|.||:|.|..:|||..|:|:::||.:|
  Fly   198 KQICAGVPSGDTCGGDSGGPLTNDVFIQGIGNR---EVQFGIISVGKTSCDGQGVYTDLMSFADW 259

  Fly   272 IFRT 275
            |..|
  Fly   260 IKMT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 86/242 (36%)
Tryp_SPc 38..272 CDD:238113 86/241 (36%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 86/242 (36%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.