DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG30087

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:281 Identity:99/281 - (35%)
Similarity:146/281 - (51%) Gaps:22/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLLVSSIIANQLLYGLAVLLEPNCG---QIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSL 67
            :::...:|..|.:.. |..|.|.||   :....||:..|.:|.:.|.|:|.::.|:....||||:
  Fly     8 FVIAICLIRQQRIVD-AQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSI 71

  Fly    68 ITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMD--SINPKHRHREYMVTRIYTHPSYRSI-AAY 129
            :.|.::|||||||.|   ||.:||||::.....|  ..|...|..||.:.:..||..|.:. ...
  Fly    72 LNSRYILTAAHCVFP---NLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVN 133

  Fly   130 DIALLKLNQTVEYTVAIRPICLVL-PENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLT 193
            ||||||||:::.:.|.|:|||::| |.:       ..||..:...|||.||......:||:|.|.
  Fly   134 DIALLKLNRSINFNVHIQPICILLNPAS-------APSVATYQTFGWGETKKNGFPHLLQTAELR 191

  Fly   194 QIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHN--RRYIHAQVGIVSRGPKNC 256
            ..|...|...:...::...||||..:...|.||||.||..:|..:  :||:  |:||||.||.:|
  Fly   192 AYDAAYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYL--QLGIVSYGPTDC 254

  Fly   257 DGVTVFTNVVSFTEWIFRTTL 277
            ....|:|.|.::..||.|..|
  Fly   255 QSPGVYTYVPNYINWIRRAML 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 87/240 (36%)
Tryp_SPc 38..272 CDD:238113 86/239 (36%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 87/240 (36%)
Tryp_SPc 42..272 CDD:238113 88/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.