DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG30083

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:273 Identity:86/273 - (31%)
Similarity:141/273 - (51%) Gaps:25/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVSSIIANQLLY--GLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNH-----LQFLCG 64
            :.:.:|....||:  .::..||||||......:|..|.:|...:.||||::..:     .:.:||
  Fly     1 MFIFTIFKIILLWPGAMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCG 65

  Fly    65 GSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYRSIAAY 129
            |:||..:|||:||||: ...:.|.|||||:..:|.. ::....|:: |..|..|::         
  Fly    66 GTLIHKQFVLSAAHCI-KRDQILAVRLGEHSSSRYF-AVTKAFRNK-YFTTGSYSN--------- 118

  Fly   130 DIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQ 194
            ||.:|::...|::...|||||::....      .|.:|:.|...|||.|:.|..|:||::..|.:
  Fly   119 DIGILRIQPIVKFNAVIRPICIITDPT------KVPNVKTFKAAGWGKTENETFSKVLKTVELNE 177

  Fly   195 IDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGV 259
            ::...|::....:|..:.||||......|.||||.||...|..:....:.|:||:|.|...|:..
  Fly   178 LNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSP 242

  Fly   260 TVFTNVVSFTEWI 272
            .|:|.:.||.:||
  Fly   243 GVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 75/239 (31%)
Tryp_SPc 38..272 CDD:238113 75/238 (32%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 75/239 (31%)
Tryp_SPc 34..255 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.