DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG30082

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:264 Identity:104/264 - (39%)
Similarity:138/264 - (52%) Gaps:18/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AVLLEPNCG---QIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPT 83
            |..::||||   .:|...||.||..|.:.|.||:|:||.:...:|.|:|||..|||||||| :.:
  Fly    21 AQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHC-LHS 84

  Fly    84 PKNLTVRLGEYDWTRQMDSIN----PKHRHREYMVTRIYTHPSY--RSIAAYDIALLKLNQTVEY 142
            ...|||||||||.:.::|..:    |  .:.||.|...|.|..:  |..:..||.|||||.||.|
  Fly    85 FHLLTVRLGEYDTSTRIDCTSEFCIP--TYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVY 147

  Fly   143 TVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYGHS 207
            .:.||||||.....      .|.....:...|||.......:.|||:.||.::|:..|......|
  Fly   148 KLFIRPICLFRDPG------QVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTS 206

  Fly   208 VDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVTVFTNVVSFTEWI 272
            :.:...|||..::..|.||||.||:.|:.:.|.....|:||||.|...|.|..|:|.|.|||.||
  Fly   207 LSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFTNWI 271

  Fly   273 FRTT 276
            ...|
  Fly   272 LSIT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 95/240 (40%)
Tryp_SPc 38..272 CDD:238113 94/239 (39%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 95/240 (40%)
Tryp_SPc 40..274 CDD:238113 96/242 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.