DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and F10

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:255 Identity:72/255 - (28%)
Similarity:114/255 - (44%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIFGGMDAGLVSTPWMAFLHN-HLQFLCGGSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQM 100
            ||.||.:......||.|.|.| ..:..|||::::..::||||||:... |...||:|:.: |.|.
Human   234 RIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQA-KRFKVRVGDRN-TEQE 296

  Fly   101 DSINPKHRHREYMVTRIYTHPSYRSIAAYDIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVD 165
            :.....|.....:....:|..:|    .:|||:|:|...:.:.:.:.|.|  |||  .:|     
Human   297 EGGEAVHEVEVVIKHNRFTKETY----DFDIAVLRLKTPITFRMNVAPAC--LPE--RDW----- 348

  Fly   166 SVEDFTLT-------GWGATKTE-PVSQVLQSANLTQIDRGTCHDRYGHSVDHTHICAG--SSKS 220
             .|...:|       |:|.|..: ..|..|:...:..:||.:|.......:.....|||  :.:.
Human   349 -AESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYDTKQE 412

  Fly   221 FACVGDSGSPLAMKVVHNRRY--IHAQVGIVSRGPKNC---DGVTVFTNVVSFTEWIFRT 275
            .||.||||.|      |..|:  .:...||||.| :.|   ....::|.|.:|.:||.|:
Human   413 DACQGDSGGP------HVTRFKDTYFVTGIVSWG-EGCARKGKYGIYTKVTAFLKWIDRS 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 69/250 (28%)
Tryp_SPc 38..272 CDD:238113 68/249 (27%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 70/251 (28%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.