DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and F9

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:255 Identity:74/255 - (29%)
Similarity:115/255 - (45%) Gaps:37/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMD 101
            |:.||.||.....||...|:..:...||||::..::::|||||| .|...:||..||::..    
Human   226 RVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCV-ETGVKITVVAGEHNIE---- 285

  Fly   102 SINPKHRHREYMVTRIYTHPSYR-SIAAY--DIALLKLNQTVEYTVAIRPICLVLPE------NF 157
              ..:|..::..|.||..|.:|. :|..|  |||||:|::.:.....:.|||:...|      .|
Human   286 --ETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKF 348

  Fly   158 HEWYWLVDSVEDFTLTGWGATKTEPVSQ-VLQSANLTQIDRGTCHDRYGHSVDHTHICAGSSKS- 220
            ...|          ::|||....:..|. |||...:..:||.||......::.:...|||..:. 
Human   349 GSGY----------VSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGG 403

  Fly   221 -FACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNC---DGVTVFTNVVSFTEWIFRTT 276
             .:|.||||.|...: |....::   .||:|.| :.|   ....::|.|..:..||...|
Human   404 RDSCQGDSGGPHVTE-VEGTSFL---TGIISWG-EECAMKGKYGIYTKVSRYVNWIKEKT 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 71/249 (29%)
Tryp_SPc 38..272 CDD:238113 70/248 (28%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 72/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.