DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and F7

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011535776.2 Gene:F7 / 2155 HGNCID:3544 Length:495 Species:Homo sapiens


Alignment Length:278 Identity:88/278 - (31%)
Similarity:125/278 - (44%) Gaps:51/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEPNCGQIPF---------RMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCV 80
            :|..||:||.         :.||.||........||...|..:...||||:||.:.:|::||||.
Human   220 VEYPCGKIPILEKRNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCF 284

  Fly    81 --MPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYRSIAAYDIALLKLNQTVEYT 143
              :...:||...|||:|.: :.|......|..:.::...|. |...:   :|||||:|:|.|..|
Human   285 DKIKNWRNLIAVLGEHDLS-EHDGDEQSRRVAQVIIPSTYV-PGTTN---HDIALLRLHQPVVLT 344

  Fly   144 VAIRPICLVLPE-NFHEWYWLVDSVEDFTLTGW------GATKTEPVSQVLQSANLTQIDRGTC- 200
            ..:.|:|  ||| .|.|  ..:..|....::||      |||..|     |...|:.::....| 
Human   345 DHVVPLC--LPERTFSE--RTLAFVRFSLVSGWGQLLDRGATALE-----LMVLNVPRLMTQDCL 400

  Fly   201 --HDRYGHSVDHTH--ICAGSS--KSFACVGDSGSPLAMKVVHNRR--YIHAQVGIVSRGPKNCD 257
              ..:.|.|.:.|.  .|||.|  ...:|.||||.|.|   .|.|.  |:   .||||.| :.|.
Human   401 QQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPHA---THYRGTWYL---TGIVSWG-QGCA 458

  Fly   258 GV---TVFTNVVSFTEWI 272
            .|   .|:|.|..:.||:
Human   459 TVGHFGVYTRVSQYIEWL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 82/255 (32%)
Tryp_SPc 38..272 CDD:238113 81/254 (32%)
F7XP_011535776.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.