DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and Proc

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:264 Identity:88/264 - (33%)
Similarity:124/264 - (46%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEPNCGQIPFRMRIFGGMDAGLVSTPWMA-FLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKNLT 88
            |||:       .||..|.......:||.| .|.:..:..|||.||.:.:||||||||..| |.||
Mouse   230 LEPD-------PRIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCVEGT-KKLT 286

  Fly    89 VRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSY-RSIAAYDIALLKLNQTVEYTVAIRPICLV 152
            |||||||..|:      .|...:..:..|..||:| ||.:..|||||:|.|....:..|.|||  
Mouse   287 VRLGEYDLRRR------DHWELDLDIKEILVHPNYTRSSSDNDIALLRLAQPATLSKTIVPIC-- 343

  Fly   153 LPEN--FHEWYWLVDSVEDFTLTGWGATKTEPVSQ-------VLQSANLTQIDRGTCHDRYGHSV 208
            ||.|  ..|   |..:.::..:|||| .:::.:..       :|....:..:.|..|.:...:.|
Mouse   344 LPNNGLAQE---LTQAGQETVVTGWG-YQSDRIKDGRRNRTFILTFIRIPLVARNECVEVMKNVV 404

  Fly   209 DHTHICAG--SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNC---DGVTVFTNVVSF 268
            ....:|||  .....||.||||.|:.:..    |.....||:||.| :.|   :...::|.|.|:
Mouse   405 SENMLCAGIIGDTRDACDGDSGGPMVVFF----RGTWFLVGLVSWG-EGCGHTNNYGIYTKVGSY 464

  Fly   269 TEWI 272
            .:||
Mouse   465 LKWI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 83/250 (33%)
Tryp_SPc 38..272 CDD:238113 82/249 (33%)
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011
FXa_inhibition 163..198 CDD:373209
Tryp_SPc 236..470 CDD:238113 84/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.