DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and Proc

DIOPT Version :10

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:264 Identity:88/264 - (33%)
Similarity:124/264 - (46%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEPNCGQIPFRMRIFGGMDAGLVSTPWMA-FLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKNLT 88
            |||:       .||..|.......:||.| .|.:..:..|||.||.:.:||||||||..| |.||
Mouse   230 LEPD-------PRIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCVEGT-KKLT 286

  Fly    89 VRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSY-RSIAAYDIALLKLNQTVEYTVAIRPICLV 152
            |||||||..|:      .|...:..:..|..||:| ||.:..|||||:|.|....:..|.|||  
Mouse   287 VRLGEYDLRRR------DHWELDLDIKEILVHPNYTRSSSDNDIALLRLAQPATLSKTIVPIC-- 343

  Fly   153 LPEN--FHEWYWLVDSVEDFTLTGWGATKTEPVSQ-------VLQSANLTQIDRGTCHDRYGHSV 208
            ||.|  ..|   |..:.::..:|||| .:::.:..       :|....:..:.|..|.:...:.|
Mouse   344 LPNNGLAQE---LTQAGQETVVTGWG-YQSDRIKDGRRNRTFILTFIRIPLVARNECVEVMKNVV 404

  Fly   209 DHTHICAG--SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNC---DGVTVFTNVVSF 268
            ....:|||  .....||.||||.|:.:..    |.....||:||.| :.|   :...::|.|.|:
Mouse   405 SENMLCAGIIGDTRDACDGDSGGPMVVFF----RGTWFLVGLVSWG-EGCGHTNNYGIYTKVGSY 464

  Fly   269 TEWI 272
            .:||
Mouse   465 LKWI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 83/250 (33%)
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011
FXa_inhibition 163..198 CDD:464251
Tryp_SPc 236..470 CDD:238113 84/251 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.