DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and try-3

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:268 Identity:82/268 - (30%)
Similarity:120/268 - (44%) Gaps:52/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FRMRIFGG--MDAGLVSTPWMAFL----HNHLQFLCGGSLITSEFVLTAAHCVMPTPKNLTVRLG 92
            |..||.||  :|.|   ..|||.|    .|....|||.::|...:::|||||.      |.::..
 Worm    34 FSFRIIGGNSIDDG---ANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCA------LQLQTR 89

  Fly    93 EYDWTRQMDSINPK-HRHREYMVTRIYTHPSYRS-IAAYDIALLKLNQTVEYTVAIRPICLVLPE 155
            .:.:.|:     || :|.|.:.|...|.|..|.: .|..|||||:::..:. .:.|:|:|||   
 Worm    90 SFVYVRE-----PKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLS-KLGIKPVCLV--- 145

  Fly   156 NFHEWYWLVDSVEDFTLTGWGAT-----KTEPV---SQVLQSANLTQIDRGTCHDRYGH----SV 208
              |:...|:...::..:.|:|.|     ..||.   ||.|||.::..|....|...:..    ||
 Worm   146 --HDDSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSV 208

  Fly   209 DHT--HICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVT-------VFTN 264
            ..|  .||||:.......||||.||   ::|.....:.|:||.|.|....|||.       |:|.
 Worm   209 KITGYQICAGAYLHGTAPGDSGGPL---LIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTR 270

  Fly   265 VVSFTEWI 272
            :..:..||
 Worm   271 ISKYVPWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 79/263 (30%)
Tryp_SPc 38..272 CDD:238113 78/262 (30%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 80/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.