DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and svh-1

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:265 Identity:73/265 - (27%)
Similarity:116/265 - (43%) Gaps:63/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIFGGMDAGLVSTPWMAFLHN------HLQFLCGGSLITSEFVLTAAHCVMPTPK--NLTVRLGE 93
            |:.||.:....:.||.|.|.|      |    ||.|::....::|||||.....:  :..|.:|:
 Worm   712 RVVGGFETVPGAFPWTAALRNKATKAHH----CGASILDKTHLITAAHCFEEDERVSSYEVVVGD 772

  Fly    94 YDWTRQMDSINPKHRHREYMVTRIYTHPSYRSIAAYDIALLKLNQT-VEYTVAIRPICLVLPENF 157
            :| ..|.|.     ..:.:.:.||:.:|.|:.|.::|||:|::... :|:....:|||  ||.  
 Worm   773 WD-NNQTDG-----NEQIFYLQRIHFYPLYKDIFSHDIAILEIPYPGIEFNEYAQPIC--LPS-- 827

  Fly   158 HEWYWLVDSVEDFTLT--------GWGATKTEPVSQVLQSANLTQIDRGTC--HDRYGHSVDHTH 212
                      :||..|        |||:.... .::.||:|.:..|:|..|  ..:...|:..:.
 Worm   828 ----------KDFVYTPGRQCVVSGWGSMGLR-YAERLQAALIPIINRFDCVNSSQIYSSMSRSA 881

  Fly   213 ICAGSSKS--FACVGDSGSPLAMKVVHNRRYIHAQV--GIVSRGPKNCDGVT------VFTNVVS 267
            .|||..:.  .:|.||||.|.|.     ||...|.|  |::|.|    ||..      ::|.|..
 Worm   882 FCAGYLEGGIDSCQGDSGGPFAC-----RREDGAFVLAGVISWG----DGCAQKKQPGIYTMVAP 937

  Fly   268 FTEWI 272
            :..||
 Worm   938 YLSWI 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 71/263 (27%)
Tryp_SPc 38..272 CDD:238113 70/262 (27%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 72/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.