DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and try-1

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:255 Identity:82/255 - (32%)
Similarity:121/255 - (47%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIFGGMDAGLVSTPWMAFLHNHL-QFLCGGSLITSEFVLTAAHCVMP--TPKNLTVRLGEYDWTR 98
            |:.||.::...|.||...|.:.| ...||||||...||||||||...  .|.:.:||:|.:    
 Worm    57 RLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGH---- 117

  Fly    99 QMDSINPKHRHREYMVTRIYTHPSYR--SIAAYDIALLKLNQTVEYTVAIRPICL-VLPENFHEW 160
            :..|.:|   ||   ||.:..||.|.  ..::||.|:::::..|..:...||||| .||      
 Worm   118 RSGSGSP---HR---VTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLPSLP------ 170

  Fly   161 YWLVDSVED--FTLTGWGAT-----KTEPVSQVLQSANLTQIDRGTCHDRYGHSVDHTHICAGSS 218
                 :||:  ..:||||:|     .:.|..:.:....|:.:...:..:..|.....:.:|||.|
 Worm   171 -----AVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYS 230

  Fly   219 --KSFACVGDSGSPLAMKVVHNRRYIHAQV-GIVSRGPKNC--DGVT-VFTNVVSFTEWI 272
              |..:|.||||.||..     .|..|.:: |:||.| ..|  .|:. |:.||.|.:.||
 Worm   231 YGKIDSCQGDSGGPLMC-----ARDGHWELTGVVSWG-IGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 80/253 (32%)
Tryp_SPc 38..272 CDD:238113 79/252 (31%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.