DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and F7

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_034302.2 Gene:F7 / 14068 MGIID:109325 Length:446 Species:Mus musculus


Alignment Length:286 Identity:84/286 - (29%)
Similarity:124/286 - (43%) Gaps:63/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEPNCGQIPF---------RMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCV 80
            :|..||:||.         :.||.||........||.|.|..:...|||..|:.:.:::|||||.
Mouse   172 VEYPCGRIPVVEKRNSSSRQGRIVGGNVCPKGECPWQAVLKINGLLLCGAVLLDARWIVTAAHCF 236

  Fly    81 --MPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSY-RSIAAYDIALLKLNQTVEY 142
              :....|:||.:||:|:: :.|......|     ||::.....| |....:|||||:|::.|.:
Mouse   237 DNIRYWGNITVVMGEHDFS-EKDGDEQVRR-----VTQVIMPDKYIRGKINHDIALLRLHRPVTF 295

  Fly   143 TVAIRPICLVLPENFHEWYWLVDSVEDFTL--------TGW------GATKTEPVSQVLQSANLT 193
            |..:.|:|  |||.         |..:.||        :||      |||..|     |.|..:.
Mouse   296 TDYVVPLC--LPEK---------SFSENTLARIRFSRVSGWGQLLDRGATALE-----LMSIEVP 344

  Fly   194 QIDRGTCHDRYGHS-----VDHTHICAG--SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSR 251
            ::....|.:...||     :.....|||  .....||.||||.|.|.. .|...|:   .|:||.
Mouse   345 RLMTQDCLEHAKHSSNTPKITENMFCAGYMDGTKDACKGDSGGPHATH-YHGTWYL---TGVVSW 405

  Fly   252 GPKNCDG---VTVFTNVVSFTEWIFR 274
            | :.|..   :.|:|.|..:.:|:.|
Mouse   406 G-EGCAAIGHIGVYTRVSQYIDWLVR 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 77/261 (30%)
Tryp_SPc 38..272 CDD:238113 76/260 (29%)
F7NP_034302.2 GLA 24..85 CDD:214503
EGF_CA 87..123 CDD:238011
FXa_inhibition 132..168 CDD:291342
Tryp_SPc 193..427 CDD:214473 77/260 (30%)
Tryp_SPc 194..431 CDD:238113 78/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.