DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and Egfbp2

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:287 Identity:73/287 - (25%)
Similarity:119/287 - (41%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYGLAVLLEPNCGQI----PFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAH 78
            ::.|.:.|..:.|.|    |.:.|:.||.:....|.||...::...:.:|||.|:...:||||||
Mouse     1 MWFLILFLALSLGGIDAAPPLQSRVVGGFNCKKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAH 65

  Fly    79 CVMPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYR------------SIAAYDI 131
            |.:   ....|.||:    .::....|..:||  :|::.:.||.:.            :..:.|:
Mouse    66 CYV---DQYEVWLGK----NKLFQEEPSAQHR--LVSKSFPHPGFNMSLLMLQTIPPGADFSNDL 121

  Fly   132 ALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGA---TKTEPVSQVLQSANLT 193
            .||:|::..:.|..::||.|...|        .........:|||:   |:.:.... ||...:|
Mouse   122 MLLRLSKPADITDVVKPIALPTKE--------PKPGSKCLASGWGSITPTRWQKPDD-LQCVFIT 177

  Fly   194 QIDRGTCHDRYGHSVDHTHICAG--SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNC 256
            .:....|...|...|....:|||  ......|..|||.||....:..        |..|.||..|
Mouse   178 LLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQ--------GTTSYGPVPC 234

  Fly   257 --DGV-TVFTNVVSFTEWIFRTTLYDA 280
              .|| .::||::.|..||..|.:.:|
Mouse   235 GKPGVPAIYTNLIKFNSWIKDTMMKNA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 64/254 (25%)
Tryp_SPc 38..272 CDD:238113 63/253 (25%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 64/254 (25%)
Tryp_SPc 25..256 CDD:238113 65/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.