DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG43336

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:269 Identity:105/269 - (39%)
Similarity:148/269 - (55%) Gaps:14/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYGLAVLLEPNCG---QIPFRMRIFGGMDAGLVSTPWMAFLHN-HLQFLCGGSLITSEFVLTAAH 78
            |.|....|:..||   ..|...|:..|..|.|.|:|||||||: ..:|:|||||||:..||||||
  Fly    15 LLGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLTAAH 79

  Fly    79 CVMPTPKNLTVRLGEYDWTRQMDSINPKH-RHR-EYMVTRIYTHPSYRSIA-AYDIALLKLNQTV 140
            |.:...: |..|||||| ..:.:..:..: .:| |.||.|.:.|..|..:. |||||:|:|.:.|
  Fly    80 CFLDRTE-LVARLGEYD-REEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRKV 142

  Fly   141 EYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYG 205
            :||..|||||:|:..   .|...:||::..|.||||.|::|..|..|::.:|.:.....|. ||.
  Fly   143 QYTDNIRPICIVIDP---RWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKHPEVCR-RYA 203

  Fly   206 H-SVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVTVFTNVVSFT 269
            . |:.....|||:.:|..|.||||.|:...:.:.:.....||||.|.....|..|:|||:|:|:.
  Fly   204 TLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVMVSVFTDVMSYV 268

  Fly   270 EWIFRTTLY 278
            :||.....|
  Fly   269 DWILAVHNY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 96/239 (40%)
Tryp_SPc 38..272 CDD:238113 95/238 (40%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 96/239 (40%)
Tryp_SPc 40..271 CDD:238113 95/236 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.