DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and CG43110

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:274 Identity:91/274 - (33%)
Similarity:137/274 - (50%) Gaps:22/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYI-SYLLVSSIIANQLLYGLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCG 64
            |.|: .::.:.|:.:.||.|  ::.|:..||:.|. .:|..|.:|...|..:||.:.|....|||
  Fly     1 MTYLFVWIFLCSLGSCQLAY--SMFLKQPCGKTPV-PKIISGSNASQQSAQYMAGIFNTTHLLCG 62

  Fly    65 GSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSY-RSIAA 128
            |::|..:||||.|||  .:.:.|.||||.|:.....|.|.         |.....||.| .|..|
  Fly    63 GTIIHEDFVLTVAHC--KSTQTLFVRLGAYNINHPTDQIR---------VIETIAHPQYSNSTYA 116

  Fly   129 YDIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLT 193
            .||||:||.::|.:.:.|:|||:.|...      |...:..:...|||.|:....|.:||...:.
  Fly   117 NDIALVKLERSVIFNLNIQPICIHLDAT------LGKQIRYYNAFGWGRTRNAEQSDILQRIFVN 175

  Fly   194 QIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDG 258
            :.:...||...|.|.|...|||.:.:...|.||||.||..|:.:..:....|.||.|.|.:.|:|
  Fly   176 RTNPMICHLYLGMSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNG 240

  Fly   259 VTVFTNVVSFTEWI 272
            |.::|:|..::.||
  Fly   241 VGLYTDVSQYSGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 79/235 (34%)
Tryp_SPc 38..272 CDD:238113 79/234 (34%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 79/235 (34%)
Tryp_SPc 36..257 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.