DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and TMPRSS11D

DIOPT Version :10

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_004253.1 Gene:TMPRSS11D / 9407 HGNCID:24059 Length:418 Species:Homo sapiens


Alignment Length:268 Identity:81/268 - (30%)
Similarity:116/268 - (43%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCG-----ISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKV 87
            :||     |:....||.||.::.....||...|.:|:...|||||:|:.::||||||||      
Human   172 ECGAGPDLITLSEQRILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFR------ 230

  Fly    88 LVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTA-HYYDIALAKLNRYVVYTDSIRPI 151
                ..::....|..:......|.|...:...|||..|::| |..||||.:|...|.:|..|..:
Human   231 ----SNSNPRDWIATSGISTTFPKLRMRVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSV 291

  Fly   152 CL-----MLNPNWQVYVDTIRYFIITGWGATN-ASEVSDKLQLTRIPQIDRFTCRYWFGY--MVD 208
            ||     .:.|....||        |||||.. |.....:|:..::..|....|.....|  .:.
Human   292 CLPAATQNIPPGSTAYV--------TGWGAQEYAGHTVPELRQGQVRIISNDVCNAPHSYNGAIL 348

  Fly   209 RTHICAGESKHYVG--KGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQ------PFHGVSVFTNIL 265
            ...:|||..:..|.  :|||||||   |.....:.:|..||||...|      |    .|:|.:.
Human   349 SGMLCAGVPQGGVDACQGDSGGPL---VQEDSRRLWFIVGIVSWGDQCGLPDKP----GVYTRVT 406

  Fly   266 SYSNWIHR 273
            :|.:||.:
Human   407 AYLDWIRQ 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 38..274 CDD:238113 77/253 (30%)
TMPRSS11DNP_004253.1 SEA 48..146 CDD:460188
Tryp_SPc 187..415 CDD:238113 77/253 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.