DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and f7

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001072819.1 Gene:f7 / 780280 XenbaseID:XB-GENE-5787186 Length:452 Species:Xenopus tropicalis


Alignment Length:287 Identity:89/287 - (31%)
Similarity:126/287 - (43%) Gaps:54/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GISLGYSYL-----LEWDCG-------ISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLL 68
            |..||...|     :.:.||       ::|.. ||.||...|....||.|.|..|..|||||:|:
 Frog   179 GYKLGADGLSCEPTVNYPCGKIPVLKNVNKRA-RIVGGDMCPKGECPWQALLMYNEIFICGGTLI 242

  Fly    69 NHWFVLTAAHCFRD-KNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYY- 131
            ...:|:|||||.:. ...|:.|.|||:    :|...|.......:..:||.:         ||| 
 Frog   243 APNWVITAAHCLKPLPENKLTVVLGEH----RIGTPEGTEQESKVSKIIMHE---------HYYG 294

  Fly   132 -------DIALAKLNRYVVYTDSIRPICLMLNPNWQVYVD---TIRYFIITGWG-ATNASEVSDK 185
                   ||||.||...|.|||.:.|:||   |..|..|.   :|||..::||| ...:....:.
 Frog   295 SKTNNDNDIALLKLTTPVNYTDYVVPLCL---PEKQFAVQELLSIRYSTVSGWGRLLESGATPEL 356

  Fly   186 LQLTRIPQIDRFTCRYWFGYMVDRTHICAG--ESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIV 248
            ||..::|::....|.......:.:...|||  :......|||||||..:    :|....|..|||
 Frog   357 LQRVQLPRVKTQDCIRQTQMNISQNMFCAGYTDGSKDSCKGDSGGPHAT----QYKNTHFLTGIV 417

  Fly   249 SH----LRQPFHGVSVFTNILSYSNWI 271
            |.    .::..:|  |:|.:..|:.||
 Frog   418 SWGLGCAKKEKYG--VYTRVSRYTEWI 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 80/252 (32%)
Tryp_SPc 38..274 CDD:238113 81/253 (32%)
f7NP_001072819.1 Gla 67..107 CDD:366184
EGF_CA 108..144 CDD:238011
FXa_inhibition 153..189 CDD:373209 4/9 (44%)
Tryp_SPc 212..445 CDD:238113 81/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.