DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and proza

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001314721.1 Gene:proza / 768176 ZFINID:ZDB-GENE-061013-403 Length:426 Species:Danio rerio


Alignment Length:212 Identity:54/212 - (25%)
Similarity:82/212 - (38%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEY 114
            ||.|.|...|...|.|.:|....|||.|.|.| |:....|.:|     :::...||....    .
Zfish   208 PWQAMLLRGSSGFCSGVILKENLVLTTAQCAR-KHPDFQVAVG-----KRMTMFESSGQT----L 262

  Fly   115 MIMQKLIHPLYRT-AHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTI----RYF-IITG 173
            .:.|..:|||:.| ....|:||.:|...:::..|:...||   |. :.:.|.:    :|. ::||
Zfish   263 AVRQVHLHPLHSTGTAENDLALLELRDRIIFKKSVAAACL---PE-RDFADRVLTAGQYMGVVTG 323

  Fly   174 WGATNASE-VSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYV-----GKGDSGGPLGS 232
            |..|...: :...|.|..:.......|        .|.|.....|...:     .|.|.....||
Zfish   324 WKDTPTEDGIEGHLLLNHLSYQTLQDC--------SRQHSAQVSSNKLMCSLPRAKADCVFGQGS 380

  Fly   233 MVDYKYAKRFFQFGIVS 249
            .|...:.:.||..|:||
Zfish   381 PVLTLHREVFFLTGMVS 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 54/212 (25%)
Tryp_SPc 38..274 CDD:238113 54/212 (25%)
prozaNP_001314721.1 GLA 28..90 CDD:214503
EGF_CA 91..127 CDD:238011
FXa_inhibition 140..164 CDD:291342
Tryp_SPc 199..423 CDD:304450 54/212 (25%)
Trypsin 199..420 CDD:278516 54/212 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.