DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and Prss56

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:252 Identity:73/252 - (28%)
Similarity:109/252 - (43%) Gaps:40/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVL--VRLGENDASQK 99
            ||.||..:|....|||..|.:....:|||.|:...:||||||||...:.::|  |.|.|....::
Mouse   109 RIVGGSTAPSGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNELLWTVMLAEGPQGEQ 173

  Fly   100 IDCNESECAAPHLEYMIMQKLIHPLY--RTAHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVY 162
            .:           |..:.:.|.||.:  :|.| .|:||.:|...|......|||||   |.....
Mouse   174 AE-----------EVQVNRILPHPKFDPQTFH-NDLALVQLWTPVSPEGPARPICL---PQGSRE 223

  Fly   163 VDTIRYFIITGWGAT-NASEVSDKLQLTRIPQIDRFTCRYWFG-YMVDRTHICAGESKHYVG--- 222
            ........|.||||. .....|:.::..|:|.:...||:...| .:...|.:|||   :..|   
Mouse   224 PPAGTPCAIAGWGALFEDGPESEAVREARVPLLSADTCQKVLGPGLRPSTMLCAG---YLAGGID 285

  Fly   223 --KGDSGGPLGSMVDYKYAKRFFQFGIVS------HLRQPFHGVSVFTNILSYSNWI 271
              :||||||| :..:.....|...||:.|      ...:|    .|:|.:..:.:|:
Mouse   286 SCQGDSGGPL-TCSEPGPRPREVLFGVTSWGDGCGEPGKP----GVYTRVTVFKDWL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 72/250 (29%)
Tryp_SPc 38..274 CDD:238113 72/251 (29%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.