DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and Proz

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_080110.1 Gene:Proz / 66901 MGIID:1860488 Length:399 Species:Mus musculus


Alignment Length:237 Identity:53/237 - (22%)
Similarity:84/237 - (35%) Gaps:53/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PWLAYL-HINSKFICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLE 113
            ||...| :...:..|.|.||...||||.|.|          .|..::.|.|.:.::        .
Mouse   194 PWQVRLTNSEGEDFCAGVLLQEDFVLTTAKC----------SLLHSNISVKANVDQ--------R 240

  Fly   114 YMIMQKLIHPLY-RTAHYYDIALAKLNRYVVYTDSIRPICL--------MLNPNWQVYVDTIRYF 169
            ..|....:|..| ..:...|::|.:|...:....|..|:|:        :|.|..:        .
Mouse   241 IRIKSTHVHMRYDEESGENDVSLLQLEEPLQCPSSGLPVCVPERDFAEHVLIPGTE--------G 297

  Fly   170 IITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYVGKGD-SGGPL--G 231
            :::|| ..|.:.::....|..:.|.|...|.......|.....|.        ||. ..||.  |
Mouse   298 LLSGW-MLNGTHLATTPMLLSVTQADGEECGQTLNVTVTTRTSCE--------KGSVVMGPWVEG 353

  Fly   232 SMVDYKYAKRFFQFGIVSHLRQPFHGVS---VFTNILSYSNW 270
            |:|..::...:|..||:.....|  |.|   :.|.:..||.|
Mouse   354 SVVTREHKGTWFLTGILGSPPPP--GQSQMLLLTAVPRYSMW 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 53/237 (22%)
Tryp_SPc 38..274 CDD:238113 53/237 (22%)
ProzNP_080110.1 GLA 23..85 CDD:214503
EGF_CA <95..122 CDD:238011
FXa_inhibition 136..165 CDD:291342
Tryp_SPc 192..397 CDD:304450 53/237 (22%)
Trypsin 192..>340 CDD:278516 35/172 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.