DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33458 and Prrg2

DIOPT Version :9

Sequence 1:	NP_995854.2	Gene:	CG33458 / 2768846	FlyBaseID:	FBgn0053458	Length:	281	Species:	Drosophila melanogaster
Sequence 2:	NP_075375.1	Gene:	Prrg2 / 65116	MGIID:	1929596	Length:	198	Species:	Mus musculus

Alignment Length:	119	Identity:	21/119 - (17%)
Similarity:	38/119 - (31%)	Gaps:	49/119 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly   109 APHLEYMIMQKLIHPLYRTAHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITG 173
            ||..:..::.:...|   .|:::|:.|       :...::...||....:|:   :...||
Mouse    36 APEAQSFLVGRRRFP---RANHWDLEL-------LTPGNLERECLEERCSWE---EAREYF---- 83

  Fly   174 WGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYVGKGDSG 227
                               :.:..|.|:|             ||..|.|||..|
Mouse    84 -------------------EDNTLTERFW-------------ESYTYNGKGGRG 105

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33458	NP_995854.2	Tryp_SPc	37..271	CDD:214473	21/119 (18%)
CG33458	NP_995854.2	Tryp_SPc	38..274	CDD:238113	21/119 (18%)
Prrg2	NP_075375.1	GLA	33..97	CDD:214503	16/109 (15%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	156..198
		LPXY motif, mediates binding to WW domain-containing proteins. /evidence=ECO:0000250\|UniProtKB:O14669	171..174
		PPXY motif, mediates binding to WW domain-containing proteins. /evidence=ECO:0000250\|UniProtKB:O14669	188..191
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24278
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100