DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and PRSS56

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001356777.1 Gene:PRSS56 / 646960 HGNCID:39433 Length:604 Species:Homo sapiens


Alignment Length:268 Identity:77/268 - (28%)
Similarity:117/268 - (43%) Gaps:48/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CG--------ISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNA 85
            ||        :::...||.||..:|....|||..|.:..:.:|||.|:...:||||||||.....
Human    88 CGERRPSTANVTRAHGRIVGGSAAPPGAWPWLVRLQLGGQPLCGGVLVAASWVLTAAHCFVGAPN 152

  Fly    86 KVL--VRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLY--RTAHYYDIALAKLNRYVVYTD 146
            ::|  |.|.|....::.:           |..:.:.|.||.:  ||.| .|:||.:|...|....
Human   153 ELLWTVTLAEGSRGEQAE-----------EVPVNRILPHPKFDPRTFH-NDLALVQLWTPVSPGG 205

  Fly   147 SIRPICLMLNPNWQVYVDTIRYFIITGWGAT-NASEVSDKLQLTRIPQIDRFTCRYWFG-YMVDR 209
            |.||:||...|. :....|.  ..|.||||. .....::.::..|:|.:...|||...| .:...
Human   206 SARPVCLPQEPQ-EPPAGTA--CAIAGWGALFEDGPEAEAVREARVPLLSTDTCRRALGPGLRPS 267

  Fly   210 THICAGESKHYVG-----KGDSGGPLGSMVDYKYAKRFFQFGIVS------HLRQPFHGVSVFTN 263
            |.:|||   :..|     :||||||| :..:.....|...||:.|      ...:|    .|:|.
Human   268 TMLCAG---YLAGGVDSCQGDSGGPL-TCSEPGPRPREVLFGVTSWGDGCGEPGKP----GVYTR 324

  Fly   264 ILSYSNWI 271
            :..:.:|:
Human   325 VAVFKDWL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 74/250 (30%)
Tryp_SPc 38..274 CDD:238113 74/251 (29%)
PRSS56NP_001356777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..96 2/7 (29%)
Tryp_SPc 105..335 CDD:238113 74/251 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.