DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and PRRG2

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_000942.1 Gene:PRRG2 / 5639 HGNCID:9470 Length:202 Species:Homo sapiens


Alignment Length:106 Identity:18/106 - (16%)
Similarity:32/106 - (30%) Gaps:46/106 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 HPLYRTAHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKL 186
            |.....|:::|:.|       :...::...||....:|:   :...||                 
Human    44 HTRIPRANHWDLEL-------LTPGNLERECLEERCSWE---EAREYF----------------- 81

  Fly   187 QLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYVGKGDSG 227
                  :.:..|.|:|..|:             |.|||..|
Human    82 ------EDNTLTERFWESYI-------------YNGKGGRG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 18/106 (17%)
Tryp_SPc 38..274 CDD:238113 18/106 (17%)
PRRG2NP_000942.1 GLA 28..95 CDD:214503 12/83 (14%)
TM_EGFR-like 109..138 CDD:213052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.