DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and prozb

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001313449.1 Gene:prozb / 558106 ZFINID:ZDB-GENE-120816-1 Length:395 Species:Danio rerio


Alignment Length:277 Identity:55/277 - (19%)
Similarity:95/277 - (34%) Gaps:76/277 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YTYRITGGRDSPLMLNP----------------W-LAYLHINSKFICGGSLLNHWFVLTAAHCFR 81
            ||....|...||.:.||                | :.:|:.:...:|.|.:|....:||:|.|..
Zfish   158 YTLNSDGRSCSPNVQNPCGTTEMSSFCPDGRCSWEVRFLNASGHDVCHGVILGQKSILTSATCMT 222

  Fly    82 D-KNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYYDIALAKLNRYVVYT 145
            . ::....|.:|.:.|:.::     ....||..::           :....|:...:|.......
Zfish   223 ALQDLHFTVAVGVSTAAVRV-----SSWTPHKRFL-----------SGPDDDLCFLELQEPFPPN 271

  Fly   146 DSIRPICLMLNPNWQVYVDTI-----RYFIITGWGAT----NASEVSDKLQLTRIPQIDRFTCRY 201
            .|..|:||   |. :.|.:.|     |..:..| |||    :..:..|.|.||            
Zfish   272 ISTVPLCL---PE-KDYSENILMRAGREGVAEG-GATYSYLSLDDCRDALNLT------------ 319

  Fly   202 WFGYMVDRTHIC-----AGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVSVF 261
               :::.....|     ||..:..|   .||.|..::    ..|..|..| ||..........:|
Zfish   320 ---FVMTNKMFCMKRESAGSERCTV---SSGSPAATL----EGKTAFLTG-VSLSAGRCGDTLLF 373

  Fly   262 TNILSYSNWIHRTIITN 278
            |.:..|.:|:...::.:
Zfish   374 TKLSRYLHWLRPLLLAS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 52/265 (20%)
Tryp_SPc 38..274 CDD:238113 53/267 (20%)
prozbNP_001313449.1 GLA 25..88 CDD:214503
EGF_CA 89..125 CDD:238011
FXa_inhibition 139..167 CDD:291342 3/8 (38%)
Tryp_SPc 182..384 CDD:304450 48/245 (20%)
Tryp_SPc 182..382 CDD:214473 47/243 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.