DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and proz

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001116189.1 Gene:proz / 496781 XenbaseID:XB-GENE-971425 Length:416 Species:Xenopus tropicalis


Alignment Length:243 Identity:56/243 - (23%)
Similarity:95/243 - (39%) Gaps:50/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PW-LAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLE 113
            || :..|:.....:|.|.:|:...|||.|.|....:...:|.    ...||....:.:.      
 Frog   198 PWQVPVLNSQKVQVCSGVVLSESVVLTTASCITMYDPYFVVA----GVQQKSGLGQRQM------ 252

  Fly   114 YMIMQKLIHPLY-RTAHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYF---IITGW 174
            ..:..|.:|..| ......:|||.||...:|:.::..|||:   |......:.:..|   :::||
 Frog   253 IRVKTKQVHMRYSEETGDNNIALLKLKEKIVFHNNSLPICI---PQKDFAENVLVPFNTGLVSGW 314

  Fly   175 GATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHIC-------------AGESKHYVGKGDS 226
             .:::.|.:|.|    ||  .:|..:|     .:||.:|             .|.|...:   ||
 Frog   315 -KSSSEEEADAL----IP--IQFYTKY-----TNRTEVCEQSLNVTQTNRMFCGVSHEAI---DS 364

  Fly   227 GGPLGSMVDYKYAKRFFQFGIVSHLRQPF---HGVSVFTNILSYSNWI 271
            ....|..:..::...:|..||:... ||.   .||..||.:..|:.|:
 Frog   365 ELSEGGHLAVQHNGVWFLGGIMGSW-QPTLLNKGVFSFTKLSRYNMWL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 55/241 (23%)
Tryp_SPc 38..274 CDD:238113 56/243 (23%)
prozNP_001116189.1 GLA 22..85 CDD:214503
EGF_CA 92..123 CDD:238011
FXa_inhibition 136..167 CDD:373209
Tryp_SPc 197..414 CDD:389826 56/243 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.